PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009594011.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 247aa    MW: 28414.9 Da    PI: 8.5595
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009594011.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.91.5e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT++Ed +l+ +v ++G  +W+  ++  g+ R++k+c++rw++yl
   XP_009594011.1 14 KGTWTPDEDRKLAAYVSKYGCWNWRQLPKFAGLSRCGKSCRLRWLNYL 61
                     799*****************99************************97 PP

2Myb_DNA-binding51.22.9e-1667110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T+eEde++ +++++ G++ W+ Ia++++ gRt++ +k++w++
   XP_009594011.1  67 RGNYTKEEDEIIMKLHAEIGNK-WSVIAAHLP-GRTDNGIKNHWHT 110
                      899*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.946961IPR017930Myb domain
SuperFamilySSF466891.73E-3011108IPR009057Homeodomain-like
SMARTSM007179.6E-111363IPR001005SANT/Myb domain
PfamPF002491.8E-141461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.9E-231568IPR009057Homeodomain-like
CDDcd001678.73E-91661No hitNo description
PROSITE profilePS5129424.44862116IPR017930Myb domain
SMARTSM007174.3E-1466114IPR001005SANT/Myb domain
PfamPF002491.2E-1467110IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-2569115IPR009057Homeodomain-like
CDDcd001672.52E-969112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MARTRCYDKS GLKKGTWTPD EDRKLAAYVS KYGCWNWRQL PKFAGLSRCG KSCRLRWLNY  60
LQPNIKRGNY TKEEDEIIMK LHAEIGNKWS VIAAHLPGRT DNGIKNHWHT SLKKRSTQEF  120
STSTDSKKRS SNNSYQSSSR KKRRENETQV NANEKIIESF QLSPMQACSE VSSCATIDQN  180
VENMNAEYSQ VFQEEIFEVS SGSFWTEPFL LDSFNTASDY IVPSVVDHGV FVSPFSPIMS  240
YDEFLLI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28121155107B-MYB
1h8a_C2e-281211525127MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1126143KKRSSNNSYQSSSRKKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009594011.10.0PREDICTED: myb-related protein Myb4-like
TrEMBLM1B2S31e-113M1B2S3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000357481e-112(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02940.14e-53myb domain protein 107